GLP-2 (1-33) is the native human form of glucagon-like peptide-2, a 33-amino-acid intestinotrophic peptide derived, like GLP-1, from post-translational processing of proglucagon in intestinal L-cells. In experimental systems it acts as an endogenous agonist of the glucagon-like peptide-2 receptor (GLP-2R), a class B G-protein-coupled receptor expressed predominantly in the gastrointestinal tract. Because "GLP-2" is a generic class designation, laboratory reference material typically corresponds to the native human GLP-2 (1-33) sequence.
In preclinical and in-vitro research, GLP-2 (1-33) has been studied as a regulator of intestinal epithelial biology, including models of crypt-cell proliferation, mucosal growth, and barrier function. Native GLP-2 is a substrate for dipeptidyl peptidase-4 (DPP-4), which cleaves its N-terminus and limits its duration of activity, a property central to studies underpinning DPP-4-resistant analogs such as teduglutide. This material is supplied strictly for Research Use Only.
HADGSFSDEMNTILDNLAARDFINWLIQTKITD
Research use only — not for human or animal consumption. Per-batch documentation is provided with the material.
In vitro and preclinical studies describe GLP-2 (1-33) as a selective agonist of the GLP-2 receptor that has been associated with intestinal epithelial proliferation and mucosal growth in animal and cell-based models. Research has also documented rapid N-terminal inactivation of native GLP-2 by DPP-4, which motivated the design of degradation-resistant analogs.
These observations derive from experimental and in-vitro settings and are provided for scientific context only. No human efficacy, dosing, or therapeutic conclusions are implied.
Glucagon-like peptide-2 was identified in the 1990s as a proglucagon-derived peptide with intestinotrophic activity, characterized notably by Drucker and colleagues, who demonstrated its role in promoting intestinal growth. This work led directly to the development of the DPP-4-resistant analog teduglutide for short bowel syndrome.
Cited literature refers to laboratory and preclinical research. GLP-2 is supplied strictly for research use only and is not intended to diagnose, treat, cure, or prevent any disease.
