Research Use Only / Third-Party Analytical Testing / Per-Batch Documentation / Materials Shipped from the USA
Cagrilintide + GLP-1 Blend research material
Vial · Research materialHelio®
Metabolic Research

Cagrilintide + GLP-1 Blend

This research blend combines two distinct metabolic peptides in a single vial: cagrilintide, a synthetic long-acting amylin analog that agonizes amylin (AMY1-3) and calcitonin receptors, and GLP-1, the native incretin peptide that agonizes the glucagon-like peptide-1 receptor (GLP-1R). Because it is a physical mixture of two molecules, the blend has no single molecular formula, weight, or CAS number; each component retains its own identity, and the relevant specifications are listed per component below.

In preclinical research, the pairing of an amylin analog with a GLP-1 receptor agonist has been of interest for studying complementary signaling across the amylin and incretin axes in models of energy balance, food intake, and glucose handling. This co-formulation mirrors the scientific rationale behind combination amylin/GLP-1 research programs. This material is supplied strictly for Research Use Only and is not for human or animal use.

Identification
  • MaterialCagrilintide + GLP-1 Blend
  • Research AreaMetabolic
  • PresentationVial
  • Available Sizes2.5mg/2.5mg (5mg) · 5mg/5mg (10mg)
  • TypeTwo-component peptide blend (amylin analog + incretin)
  • Receptor / TargetAmylin / calcitonin receptors (cagrilintide) and GLP-1R (GLP-1)
Analytical Data
  • Purity (HPLC)≥99%
  • Identity (MS)Confirmed to specification
  • TestingAccredited (ISO 17025) third-party laboratory
  • DocumentationPer-batch COA →
From$89.95 – $169.95

Research use only — not for human or animal consumption. Per-batch documentation is provided with the material.

Component Profiles

Cagrilintide

  • FormulaC194H312N54O59S2
  • Weight4409.1 g/mol
  • CAS1415456-99-3
  • StructureSynthetic 37-residue acylated cyclic peptide; (Eicosanedioic acid-γ-Glu)-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2 with Cys2-Cys7 disulfide
  • ReceptorAmylin receptors (AMY1-3) and calcitonin receptor (CTR)

GLP-1 (7-37)

  • FormulaC151H228N40O47
  • Weight3355.71 g/mol
  • CAS106612-94-6
  • StructureNative linear 30-residue incretin peptide; HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
  • ReceptorGlucagon-like peptide-1 receptor (GLP-1R)
Key Characteristics
Molecular TypeTwo-component peptide blend
Receptor / TargetAmylin/calcitonin receptors and GLP-1R
FormCo-lyophilized powder in vial
SolubilitySoluble in water and bacteriostatic water; aliquot after reconstitution
StorageStore lyophilized at -20 C to -80 C; protect from light
StabilityLyophilized stable for extended periods frozen; reconstituted solutions less stable, use promptly
Research Context
Amylin / incretin co-signalingModel system for complementary activation of amylin and GLP-1 receptor axes.
Energy balance researchUsed in preclinical study of food intake and body-weight regulation.
Glucose homeostasisCombined agonism studied in cell-based and animal glucose-handling models.
Combination formulation studiesReflects the research rationale of amylin/GLP-1 combination approaches.
Research Findings

Preclinical research on combined amylin-analog and GLP-1 receptor agonist administration has explored whether the two mechanisms produce complementary effects on satiety, food intake, and metabolic parameters relative to either agent alone. Findings are specific to the experimental models used and to the individual pharmacology of each component.

These observations derive from experimental and preclinical settings and are provided for scientific context only. No human efficacy, dosing, or therapeutic conclusions are implied by this listing.

History

The scientific rationale for pairing an amylin analog with a GLP-1 agonist grew out of parallel development of long-acting amylin analogs such as cagrilintide and the established GLP-1 incretin field, exemplified by combination programs studying amylin plus GLP-1 receptor agonism for metabolic research.

References
  1. Kruse T, et al. (2021). Development of Cagrilintide, a Long-Acting Amylin Analogue. Journal of Medicinal Chemistry.
  2. Enebo LB, et al. (2021). Safety, tolerability, pharmacokinetics, and pharmacodynamics of concomitant administration of multiple doses of cagrilintide with semaglutide 2.4 mg for weight management: a randomised, controlled, phase 1b trial. The Lancet.
  3. Mojsov S, Weir GC, Habener JF (1987). Insulinotropin: glucagon-like peptide I (7-37) co-encoded in the glucagon gene is a potent stimulator of insulin release in the perfused rat pancreas. Journal of Clinical Investigation.

Cited literature refers to laboratory and preclinical research. Cagrilintide + GLP-1 Blend is supplied strictly for research use only and is not intended to diagnose, treat, cure, or prevent any disease.

Why researchers choose Helio
99%+ PurityHPLC-verified every batch
Accredited TestingIndependent ISO 17025 laboratory
Per-Batch COADocumentation tied to your lot
Made in the USADiscreet, protected shipping
Related

More in Metabolic

View area