GLP-1 (7-37) is the fully processed, biologically active form of glucagon-like peptide-1, a 30-amino-acid incretin hormone derived from the proglucagon gene and secreted by intestinal L-cells. In experimental systems it is characterized as an endogenous agonist of the glucagon-like peptide-1 receptor (GLP-1R), a class B G-protein-coupled receptor. Because "GLP-1" is a generic class designation rather than a single proprietary molecule, laboratory reference material most commonly corresponds to the native GLP-1 (7-37) or GLP-1 (7-36) amide sequence.
In preclinical and in-vitro research, GLP-1 (7-37) has been widely used as a model incretin ligand to probe receptor pharmacology, cyclic-AMP signaling, and glucose-dependent insulinotropic pathways in pancreatic islet and cell-line systems. Native GLP-1 is rapidly cleaved by dipeptidyl peptidase-4 (DPP-4), a property that has made it a foundational reference compound in studies of peptide stability and in the design of longer-acting GLP-1R agonists. This material is supplied strictly for Research Use Only.
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
Research use only — not for human or animal consumption. Per-batch documentation is provided with the material.
In vitro and preclinical studies describe GLP-1 (7-37) as a high-affinity agonist of the GLP-1 receptor that stimulates adenylate-cyclase and cAMP accumulation, effects that have been used to characterize glucose-dependent insulinotropic activity in pancreatic islet and transfected cell-line models. Investigations have also documented the rapid inactivation of native GLP-1 by DPP-4 through cleavage of the N-terminal His-Ala dipeptide.
These observations are drawn from experimental and in-vitro settings and are provided for scientific context only. No human efficacy, dosing, or therapeutic conclusions are implied.
Glucagon-like peptide-1 was identified in the 1980s following the cloning of the proglucagon gene, and the truncated GLP-1 (7-37) and GLP-1 (7-36) amide forms were subsequently established as the active incretin species by Orskov, Holst, and colleagues. This work laid the biochemical foundation for the incretin field and the later development of GLP-1 receptor agonists and DPP-4 inhibitors.
View compound profile on NIH PubChem →
Cited literature refers to laboratory and preclinical research. GLP-1 is supplied strictly for research use only and is not intended to diagnose, treat, cure, or prevent any disease.
